RASL12 anticorps (N-Term)

N° du produit ABIN634395

Détail du produit anti-RASL12 anticorps

Antigène: RASL12 (RAS-Like, Family 12 (RASL12))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASL12 est non-conjugé

Application: Western Blotting (WB)

Specificité: RASL12 antibody was raised against the N terminal of RASL12

Purification: Affinity purified

Immunogène: RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASL12 Blocking Peptide, catalog no. 33R-6517, is also available for use as a blocking control in assays to test for specificity of this RASL12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASL12

Antigène: RASL12 (RAS-Like, Family 12 (RASL12))

Autre désignation: RASL12 (RASL12 Produits)

Synonymes: anticorps RIS, anticorps 4631404I11Rik, anticorps zgc:63633, anticorps RAS like family 12, anticorps RAS-like, family 12, anticorps RASL12, anticorps Rasl12, anticorps rasl12

Sujet: The function of RASL12 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)