ALOX15 anticorps (Middle Region)
-
- Antigène Voir toutes ALOX15 Anticorps
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALOX15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALOX15 antibody was raised against the middle region of ALOX15
- Purification
- Affinity purified
- Immunogène
- ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
- Top Product
- Discover our top product ALOX15 Anticorps primaire
-
anti-Arachidonate 15-Lipoxygenase (ALOX15) antibody
ALOX15 Reactivité: Humain, Rat, Singe, Chien WB, IHC, IHC (p), IF Hôte: Souris Monoclonal 3G8 unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 1-662) antibodyALOX15 Reactivité: Humain WB, ELISA, IHC (p) Hôte: Souris Monoclonal 3D8 unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 610-643), (C-Term) antibodyALOX15 Reactivité: Humain WB, IHC (p), IF Hôte: Lapin Polyclonal RB17156 unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 2-337) antibodyALOX15 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 170-312) antibodyALOX15 Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C2 unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) antibodyALOX15 Reactivité: Humain WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 1-662) antibodyALOX15 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (Internal Region) antibodyVerified ALOX15 Reactivité: Humain WB, IHC, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) antibodyALOX15 Reactivité: Humain, Rat, Souris IHC Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase (ALOX15) (AA 1-225) antibodyALOX15 Reactivité: Humain IHC, ELISA, IF Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALOX15 Blocking Peptide, catalog no. 33R-7578, is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
- Autre désignation
- ALOX15 (ALOX15 Produits)
- Synonymes
- anticorps 15-LOX-1, anticorps 15LOX-1, anticorps ALOX15, anticorps 12-LO, anticorps Alox12l, anticorps L-12LO, anticorps 12-LOX, anticorps Alox12, anticorps ALOX12, anticorps 15-LOX, anticorps Alox12e, anticorps arachidonate 15-lipoxygenase, anticorps Arachidonate 15-lipoxygenase, anticorps ALOX15, anticorps Alox15, anticorps Nmul_A0532, anticorps Sden_1680, anticorps Swoo_2919, anticorps PCC8801_3106, anticorps Cyan8802_3014, anticorps Nwat_1315
- Sujet
- ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-
