RAB15 anticorps (N-Term)

N° du produit ABIN634404

Détail du produit anti-RAB15 anticorps

Antigène: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB15 est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB15 antibody was raised against the N terminal of RAB15

Purification: Affinity purified

Immunogène: RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB15

Antigène: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Autre désignation: RAB15 (RAB15 Produits)

Synonymes: anticorps si:dkey-263p20.2, anticorps zgc:86635, anticorps 2310012G06Rik, anticorps AI840042, anticorps RAB15, member RAS oncogene family, anticorps RAB15, member RAS oncogene family S homeolog, anticorps rab15, anticorps rab15.S, anticorps RAB15, anticorps Rab15

Sujet: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Poids moléculaire: 23 kDa (MW of target protein)