RAB39B anticorps (N-Term)

N° du produit ABIN634406

Détail du produit anti-RAB39B anticorps

Antigène: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB39B est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB39 B antibody was raised against the N terminal of RAB39

Purification: Affinity purified

Immunogène: RAB39 B antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB39B Blocking Peptide, catalog no. 33R-5891, is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB39B

Antigène: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Autre désignation: RAB39B (RAB39B Produits)

Synonymes: anticorps RAB39B, anticorps LOC100221662, anticorps zgc:153068, anticorps MRX72, anticorps 6330580M05Rik, anticorps RAB39B, member RAS oncogene family, anticorps RAB39B, member RAS oncogene family a, anticorps RAB39B, member RAS oncogene family b, anticorps RAB39B, anticorps rab39ba, anticorps rab39bb, anticorps Rab39b

Sujet: RAB39B may be involved in vesicular trafficking.

Poids moléculaire: 24 kDa (MW of target protein)