ASB8 anticorps (N-Term)

N° du produit ABIN634410

Détail du produit anti-ASB8 anticorps

Antigène: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASB8 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASB8 antibody was raised against the N terminal of ASB8

Purification: Affinity purified

Immunogène: ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASB8 Blocking Peptide, catalog no. 33R-6512, is also available for use as a blocking control in assays to test for specificity of this ASB8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASB8

Antigène: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Autre désignation: ASB8 (ASB8 Produits)

Synonymes: anticorps wu:fd16d08, anticorps zgc:64033, anticorps 4930539L19Rik, anticorps AI788835, anticorps C430011H06Rik, anticorps ankyrin repeat and SOCS box containing 8, anticorps ankyrin repeat and SOCS box-containing 8, anticorps ASB8, anticorps asb8, anticorps Asb8

Sujet: ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Poids moléculaire: 32 kDa (MW of target protein)