RHOBTB1 anticorps (Middle Region)

N° du produit ABIN634415

L’anticorps Lapin Polyclonal anti-RHOBTB1 a été validé pour WB et IHC. Il convient pour détecter RHOBTB1 dans des échantillons de Humain, Souris, Chien et Rat.

Aperçu rapide pour RHOBTB1 anticorps (Middle Region) (ABIN634415)

Antigène: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOBTB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RHOBTB1 anticorps

Épitope: Middle Region

Specificité: RHOBTB1 antibody was raised against the middle region of RHOBTB1

Purification: Affinity purified

Immunogène: RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOBTB1 Blocking Peptide, (ABIN937473), is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOBTB1

Antigène: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Autre désignation: RHOBTB1

Sujet: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

Poids moléculaire: 77 kDa (MW of target protein)