Pkc beta 1 anticorps (N-Term)

N° du produit ABIN634421

L’anticorps Lapin Polyclonal anti-Pkc beta 1 a été validé pour WB. Il convient pour détecter Pkc beta 1 dans des échantillons de Rat, Humain et Souris.

Aperçu rapide pour Pkc beta 1 anticorps (N-Term) (ABIN634421)

Antigène: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pkc beta 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Pkc beta 1 anticorps

Épitope: N-Term

Specificité: PRKCB1 antibody was raised against the N terminal of PRKCB1

Purification: Affinity purified

Immunogène: PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKCB1 Blocking Peptide, (ABIN5615556), is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pkc beta 1

Antigène: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Autre désignation: PRKCB1

Sujet: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Poids moléculaire: 77 kDa (MW of target protein)