RAB40A anticorps (Middle Region)

N° du produit ABIN634428

Détail du produit anti-RAB40A anticorps

Antigène: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB40A est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB40 A antibody was raised against the middle region of RAB40

Purification: Affinity purified

Immunogène: RAB40 A antibody was raised using the middle region of RAB40 corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB40A

Antigène: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Autre désignation: RAB40A (RAB40A Produits)

Synonymes: anticorps RAR2, anticorps RAR2A, anticorps RAB40A, member RAS oncogene family, anticorps RAB40A

Sujet: RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Poids moléculaire: 31 kDa (MW of target protein)