TP53TG5 anticorps (N-Term)

N° du produit ABIN634430

Détail du produit anti-TP53TG5 anticorps

Antigène: TP53TG5 (TP53 Target 5 (TP53TG5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TP53TG5 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF10 antibody was raised against the N terminal Of C20 rf10

Purification: Affinity purified

Immunogène: C20 ORF10 antibody was raised using the N terminal Of C20 rf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF10 Blocking Peptide, catalog no. 33R-8050, is also available for use as a blocking control in assays to test for specificity of this C20ORF10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TP53TG5

Antigène: TP53TG5 (TP53 Target 5 (TP53TG5))

Autre désignation: C20ORF10 (TP53TG5 Produits)

Synonymes: anticorps TP53TG5, anticorps C20orf10, anticorps CLG01, anticorps TP53 target 5, anticorps TP53TG5

Sujet: C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.

Poids moléculaire: 32 kDa (MW of target protein)