TBL3 anticorps

N° du produit ABIN634442

L’anticorps anti-TBL3 Polyclonal Lapin est utilisé pour la détection de TBL3 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TBL3 anticorps (ABIN634442)

Antigène: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBL3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TBL3 anticorps

Purification: Affinity purified

Immunogène: TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBL3 Blocking Peptide, (ABIN5616523), is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBL3

Antigène: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Autre désignation: TBL3

Sujet: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.

Poids moléculaire: 89 kDa (MW of target protein)