Adenylate Kinase 3 anticorps (N-Term)

N° du produit ABIN634447

Cet anticorps Lapin Polyclonal détecte spécifiquement Adenylate Kinase 3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Adenylate Kinase 3 anticorps (N-Term) (ABIN634447)

Antigène: Adenylate Kinase 3 (AK3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adenylate Kinase 3 anticorps

Épitope: N-Term

Specificité: AK3 antibody was raised against the N terminal of AK3

Purification: Affinity purified

Immunogène: AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK3 Blocking Peptide, (ABIN5611984), is also available for use as a blocking control in assays to test for specificity of this AK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 3

Antigène: Adenylate Kinase 3 (AK3)

Autre désignation: AK3

Sujet: The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process