NKIRAS1 anticorps (N-Term)

N° du produit ABIN634451

Détail du produit anti-NKIRAS1 anticorps

Antigène: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKIRAS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NKIRAS1 antibody was raised against the N terminal of NKIRAS1

Purification: Affinity purified

Immunogène: NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKIRAS1 Blocking Peptide, catalog no. 33R-1680, is also available for use as a blocking control in assays to test for specificity of this NKIRAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKIRAS1

Antigène: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Autre désignation: NKIRAS1 (NKIRAS1 Produits)

Synonymes: anticorps NKIRAS1, anticorps KBRAS1, anticorps kappaB-Ras1, anticorps zgc:92823, anticorps kbras1, anticorps 2400004O09Rik, anticorps NFKB inhibitor interacting Ras like 1, anticorps NFKB inhibitor interacting Ras-like 1, anticorps NFKB inhibitor interacting Ras-like 1 S homeolog, anticorps NFKB inhibitor interacting Ras-like protein 1, anticorps NKIRAS1, anticorps nkiras1, anticorps nkiras1.S, anticorps Nkiras1

Sujet: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Poids moléculaire: 22 kDa (MW of target protein)