ADAR anticorps (N-Term)

N° du produit ABIN634454

L’anticorps Lapin Polyclonal anti-ADAR a été validé pour WB. Il convient pour détecter ADAR dans des échantillons de Humain.

Aperçu rapide pour ADAR anticorps (N-Term) (ABIN634454)

Antigène: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADAR anticorps

Épitope: N-Term

Specificité: ADAR antibody was raised against the N terminal of ADAR

Purification: Affinity purified

Immunogène: ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAR Blocking Peptide, (ABIN938614), is also available for use as a blocking control in assays to test for specificity of this ADAR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAR

Antigène: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Autre désignation: ADAR

Sujet: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Poids moléculaire: 136 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus