ADAR anticorps (N-Term)

N° du produit ABIN634454

Détail du produit anti-ADAR anticorps

Antigène: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAR est non-conjugé

Application: Western Blotting (WB)

Specificité: ADAR antibody was raised against the N terminal of ADAR

Purification: Affinity purified

Immunogène: ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAR Blocking Peptide, catalog no. 33R-3228, is also available for use as a blocking control in assays to test for specificity of this ADAR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAR

Antigène: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Autre désignation: ADAR (ADAR Produits)

Synonymes: anticorps red1, anticorps drada, anticorps wu:fc22a02, anticorps adar1, anticorps dsRAD, anticorps dsRAD-1, anticorps ADAR, anticorps ADAR1, anticorps CG12598, anticorps Dmel\\CG12598, anticorps EG:BACN35H14.1, anticorps adar, anticorps adr, anticorps cg12598, anticorps dADAR, anticorps dAdar, anticorps hypnos-2, anticorps NV18763, anticorps AGS6, anticorps DRADA, anticorps DSH, anticorps DSRAD, anticorps G1P1, anticorps IFI-4, anticorps IFI4, anticorps K88DSRBP, anticorps P136, anticorps AV242451, anticorps Adar1, anticorps mZaADAR, anticorps adenosine deaminase, RNA-specific, anticorps adenosine deaminase, RNA-specific S homeolog, anticorps adenosine deaminase, RNA specific, anticorps Adenosine deaminase acting on RNA, anticorps adenosine deaminase acting on RNA, anticorps double-stranded RNA-specific editase 1, anticorps adar, anticorps adar.S, anticorps ADAR, anticorps Adar, anticorps CpipJ_CPIJ011849, anticorps LOC100114127

Sujet: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Poids moléculaire: 136 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus