RCAN3 anticorps (Middle Region)

N° du produit ABIN634456

Cet anticorps Lapin Polyclonal détecte spécifiquement RCAN3 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RCAN3 anticorps (Middle Region) (ABIN634456)

Antigène: RCAN3 (RCAN Family Member 3 (RCAN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RCAN3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RCAN3 anticorps

Épitope: Middle Region

Specificité: RCAN3 antibody was raised against the middle region of RCAN3

Purification: Affinity purified

Immunogène: RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RCAN3 Blocking Peptide, (ABIN5615813), is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCAN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RCAN3

Antigène: RCAN3 (RCAN Family Member 3 (RCAN3))

Autre désignation: RCAN3

Sujet: RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.

Poids moléculaire: 27 kDa (MW of target protein)