OAS2 anticorps (N-Term)

N° du produit ABIN634458

Cet anticorps anti-OAS2 Polyclonal Lapin (ABIN634458) détecte spécifiquement OAS2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour OAS2 anticorps (N-Term) (ABIN634458)

Antigène: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OAS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OAS2 anticorps

Épitope: N-Term

Specificité: OAS2 antibody was raised against the N terminal of OAS2

Purification: Affinity purified

Immunogène: OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OAS2 Blocking Peptide, (ABIN937298), is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OAS2

Antigène: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Autre désignation: OAS2

Sujet: OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.

Poids moléculaire: 79 kDa (MW of target protein)

Pathways: Hepatitis C