APOBEC3G anticorps (N-Term)

N° du produit ABIN634462

Cet anticorps Lapin Polyclonal détecte spécifiquement APOBEC3G dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour APOBEC3G anticorps (N-Term) (ABIN634462)

Antigène: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOBEC3G est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-APOBEC3G anticorps

Épitope: N-Term

Specificité: ApoBEC3 G antibody was raised against the N terminal of APOBEC3

Purification: Affinity purified

Immunogène: ApoBEC3 G antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOBEC3G

Antigène: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Autre désignation: ApoBEC3G

Sujet: APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

Poids moléculaire: 46 kDa (MW of target protein)