RBM9 anticorps (Middle Region)

N° du produit ABIN634463

L’anticorps Lapin Polyclonal anti-RBM9 a été validé pour WB. Il convient pour détecter RBM9 dans des échantillons de Humain.

Aperçu rapide pour RBM9 anticorps (Middle Region) (ABIN634463)

Antigène: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM9 anticorps

Épitope: Middle Region

Specificité: RBM9 antibody was raised against the middle region of RBM9

Purification: Affinity purified

Immunogène: RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM9 Blocking Peptide, (ABIN5615798), is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM9

Antigène: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Autre désignation: RBM9

Sujet: RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development