SDCBP2 anticorps

N° du produit ABIN634476

Cet anticorps anti-SDCBP2 Polyclonal Lapin (ABIN634476) détecte spécifiquement SDCBP2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SDCBP2 anticorps (ABIN634476)

Antigène: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDCBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SDCBP2 anticorps

Purification: Affinity purified

Immunogène: SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDCBP2 Blocking Peptide, (ABIN5616023), is also available for use as a blocking control in assays to test for specificity of this SDCBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDCBP2

Antigène: SDCBP2 (Syndecan Binding Protein (Syntenin) 2 (SDCBP2))

Autre désignation: SDCBP2

Sujet: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Poids moléculaire: 23 kDa (MW of target protein)