VPREB1 anticorps (Middle Region)

N° du produit ABIN634478

Détail du produit anti-VPREB1 anticorps

Antigène: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPREB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: VPREB1 antibody was raised against the middle region of VPREB1

Purification: Affinity purified

Immunogène: VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPREB1

Antigène: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Autre désignation: VPREB1 (VPREB1 Produits)

Synonymes: anticorps IGI, anticorps IGVPB, anticorps VPREB, anticorps VpreB, anticorps CD179a, anticorps Vpreb-1, anticorps V-set pre-B cell surrogate light chain 1, anticorps immunoglobulin iota chain, anticorps immunoglobulin iota chain-like, anticorps pre-B lymphocyte 1, anticorps pre-B lymphocyte gene 1, anticorps VPREB1, anticorps LOC698810, anticorps LOC486411, anticorps Vpreb1

Sujet: VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Regulation of Cell Size