SFTPD anticorps (Middle Region)

N° du produit ABIN634484

L’anticorps anti-SFTPD Polyclonal Lapin est utilisé pour la détection de SFTPD dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SFTPD anticorps (Middle Region) (ABIN634484)

Antigène: SFTPD (Surfactant Protein D (SFTPD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFTPD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SFTPD anticorps

Épitope: Middle Region

Specificité: SFTPD antibody was raised against the middle region of SFTPD

Purification: Affinity purified

Immunogène: SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFTPD Blocking Peptide, (ABIN5616110), is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFTPD

Antigène: SFTPD (Surfactant Protein D (SFTPD))

Autre désignation: SFTPD

Sujet: SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.

Poids moléculaire: 35 kDa (MW of target protein)