Fetuin A anticorps (N-Term)

N° du produit ABIN634489

Cet anticorps Lapin Polyclonal détecte spécifiquement Fetuin A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Fetuin A anticorps (N-Term) (ABIN634489)

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fetuin A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Fetuin A anticorps

Épitope: N-Term

Specificité: AHSG antibody was raised against the N terminal of AHSG

Purification: Affinity purified

Immunogène: AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHSG Blocking Peptide, (ABIN936837), is also available for use as a blocking control in assays to test for specificity of this AHSG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHSG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fetuin A

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Autre désignation: AHSG

Sujet: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.

Poids moléculaire: 39 kDa (MW of target protein)