Fetuin A anticorps (N-Term)

N° du produit ABIN634489

Détail du produit anti-Fetuin A anticorps

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fetuin A est non-conjugé

Application: Western Blotting (WB)

Specificité: AHSG antibody was raised against the N terminal of AHSG

Purification: Affinity purified

Immunogène: AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHSG Blocking Peptide, catalog no. 33R-1451, is also available for use as a blocking control in assays to test for specificity of this AHSG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHSG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fetuin A

Antigène: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Autre désignation: AHSG (AHSG Produits)

Synonymes: anticorps ahs, anticorps a2hs, anticorps hsga, anticorps fetua, anticorps wu:fb63g02, anticorps zgc:103687, anticorps AHSG, anticorps MGC116429, anticorps A2HS, anticorps AHS, anticorps FETUA, anticorps HSGA, anticorps Aa2-066, anticorps pp63, anticorps alpha-2-HS-glycoprotein, anticorps alpha 2-HS glycoprotein, anticorps alpha-2-HS-glycoprotein 1, anticorps alpha-2-HS-glycoprotein L homeolog, anticorps Cphamn1_1981, anticorps AHSG, anticorps ahsg, anticorps ahsg1, anticorps ahsg.L, anticorps Ahsg

Sujet: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.

Poids moléculaire: 39 kDa (MW of target protein)