Complement C2 anticorps (N-Term)

N° du produit ABIN634491

Détail du produit anti-Complement C2 anticorps

Antigène: Complement C2

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Complement C2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Complement C2 antibody was raised against the N terminal of C2

Purification: Affinity purified

Immunogène: Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Complement C2 Blocking Peptide, catalog no. 33R-2634, is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Complement C2

Antigène: Complement C2

Abstract: Complement C2 Produits

Synonymes: anticorps CO2, anticorps complement C2, anticorps complement component 2 (within H-2S), anticorps C2

Sujet: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Poids moléculaire: 81 kDa (MW of target protein)