SAA4 anticorps (Middle Region)

N° du produit ABIN634497

Cet anticorps anti-SAA4 Polyclonal Lapin (ABIN634497) détecte spécifiquement SAA4 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SAA4 anticorps (Middle Region) (ABIN634497)

Antigène: SAA4 (Serum Amyloid A 4 (SAA4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAA4 anticorps

Épitope: Middle Region

Specificité: SAA4 antibody was raised against the middle region of SAA4

Purification: Affinity purified

Immunogène: SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAA4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SAA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAA4

Antigène: SAA4 (Serum Amyloid A 4 (SAA4))

Autre désignation: SAA4

Sujet: SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

Poids moléculaire: 2 kDa (MW of target protein)