LGALS1/Galectin 1 anticorps

N° du produit ABIN634507

Détail du produit anti-LGALS1/Galectin 1 anticorps

Antigène: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS1/Galectin 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS1 Blocking Peptide, catalog no. 33R-2676, is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LGALS1/Galectin 1

Antigène: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Autre désignation: LGALS1 (LGALS1 Produits)

Synonymes: anticorps GAL1, anticorps GBP, anticorps Galectin-1, anticorps LGAS1, anticorps LGALS1, anticorps MGC64502, anticorps GB10026, anticorps AA410090, anticorps Gal-1, anticorps Galbp, anticorps L-14.5, anticorps L14, anticorps Lect14, anticorps galectin-1, anticorps Galaptin, anticorps galectin 1, anticorps galectin-1, anticorps lectin, galactoside-binding, soluble, 1 L homeolog, anticorps protein enabled, anticorps lectin, galactose binding, soluble 1, anticorps LGALS1, anticorps Lgals1, anticorps CC1G_05003, anticorps CC1G_05004, anticorps lgals1.L, anticorps LOC408848

Sujet: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis