LGALS1/Galectin 1 anticorps

N° du produit ABIN634507

Cet anticorps Lapin Polyclonal détecte spécifiquement LGALS1/Galectin 1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour LGALS1/Galectin 1 anticorps (ABIN634507)

Antigène: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS1/Galectin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LGALS1/Galectin 1 anticorps

Purification: Affinity purified

Immunogène: LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS1 Blocking Peptide, (ABIN938062), is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LGALS1/Galectin 1

Antigène: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Autre désignation: LGALS1

Sujet: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis