CXCR2 anticorps (N-Term)

N° du produit ABIN634514

L’anticorps anti-CXCR2 Polyclonal Lapin est utilisé pour la détection de CXCR2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CXCR2 anticorps (N-Term) (ABIN634514)

Antigène: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXCR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CXCR2 anticorps

Épitope: N-Term

Specificité: IL8 RB antibody was raised against the N terminal of IL8 B

Purification: Affinity purified

Immunogène: IL8 RB antibody was raised using the N terminal of IL8 B corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL8RB Blocking Peptide, (ABIN5614178), is also available for use as a blocking control in assays to test for specificity of this IL8RB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CXCR2

Antigène: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Autre désignation: IL8RB

Sujet: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process