CHST15 anticorps (Middle Region)

N° du produit ABIN634517

L’anticorps anti-CHST15 Polyclonal Lapin est utilisé pour la détection de CHST15 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour CHST15 anticorps (Middle Region) (ABIN634517)

Antigène: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHST15 anticorps

Épitope: Middle Region

Specificité: GALNAC4 S-4 T antibody was raised against the middle region of GALNAC4 -4 T

Purification: Affinity purified

Immunogène: GALNAC4 S-4 T antibody was raised using the middle region of GALNAC4 -4 T corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNAC4S-6ST Blocking Peptide, (ABIN936033), is also available for use as a blocking control in assays to test for specificity of this GALNAC4S-6ST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNAC0 -0 T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST15

Antigène: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Autre désignation: GALNAC4S-6ST

Sujet: GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression, however such results are unclear in vivo.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process