FKBP8 anticorps (N-Term)
-
- Antigène Voir toutes FKBP8 Anticorps
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FKBP8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FKBP8 antibody was raised against the N terminal of FKBP8
- Purification
- Affinity purified
- Immunogène
- FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS
- Top Product
- Discover our top product FKBP8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FKBP8 Blocking Peptide, catalog no. 33R-3478, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
- Autre désignation
- FKBP8 (FKBP8 Produits)
- Synonymes
- anticorps FKBP8, anticorps fkbp8, anticorps 38kDa, anticorps FKBP-38, anticorps FKBP-8, anticorps Fkbp38, anticorps zgc:77672, anticorps FKBP38, anticorps FKBPr38, anticorps FK506 binding protein 8, anticorps FK506 binding protein 8 L homeolog, anticorps FKBP8, anticorps fkbp8, anticorps Fkbp8, anticorps fkbp8.L
- Sujet
- FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Autophagy
-