NMBR anticorps (N-Term)

N° du produit ABIN634529

L’anticorps Lapin Polyclonal anti-NMBR a été validé pour WB. Il convient pour détecter NMBR dans des échantillons de Humain.

Aperçu rapide pour NMBR anticorps (N-Term) (ABIN634529)

Antigène: NMBR (Neuromedin B Receptor (NMBR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMBR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NMBR anticorps

Épitope: N-Term

Specificité: NMBR antibody was raised against the N terminal of NMBR

Purification: Affinity purified

Immunogène: NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NMBR Blocking Peptide, (ABIN5615008), is also available for use as a blocking control in assays to test for specificity of this NMBR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMBR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NMBR

Antigène: NMBR (Neuromedin B Receptor (NMBR))

Autre désignation: NMBR

Sujet: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.

Poids moléculaire: 43 kDa (MW of target protein)