NMBR anticorps (N-Term)
-
- Antigène Voir toutes NMBR Anticorps
- NMBR (Neuromedin B Receptor (NMBR))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NMBR est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NMBR antibody was raised against the N terminal of NMBR
- Purification
- Affinity purified
- Immunogène
- NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
- Top Product
- Discover our top product NMBR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NMBR Blocking Peptide, catalog no. 33R-7356, is also available for use as a blocking control in assays to test for specificity of this NMBR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMBR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NMBR (Neuromedin B Receptor (NMBR))
- Autre désignation
- NMBR (NMBR Produits)
- Synonymes
- anticorps NMBR, anticorps si:dkey-283f18.1, anticorps BB182387, anticorps NMB-R, anticorps neuromedin B receptor, anticorps NMBR, anticorps nmbr, anticorps Nmbr
- Sujet
- Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.
- Poids moléculaire
- 43 kDa (MW of target protein)
-