GLP2R anticorps (N-Term)

N° du produit ABIN634532

Détail du produit anti-GLP2R anticorps

Antigène: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLP2R est non-conjugé

Application: Western Blotting (WB)

Specificité: GLP2 R antibody was raised against the N terminal of GLP2

Purification: Affinity purified

Immunogène: GLP2 R antibody was raised using the N terminal of GLP2 corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLP2R Blocking Peptide, catalog no. 33R-4510, is also available for use as a blocking control in assays to test for specificity of this GLP2R antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLP2R

Antigène: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Autre désignation: GLP2R (GLP2R Produits)

Synonymes: anticorps 9530092J08Rik, anticorps GLP-2, anticorps glucagon like peptide 2 receptor, anticorps glucagon-like peptide 2 receptor, anticorps GLP2R, anticorps Glp2r

Sujet: The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Feeding Behaviour