UQCRFS1 anticorps (N-Term)

N° du produit ABIN634545

Cet anticorps anti-UQCRFS1 est un anticorps Lapin Polyclonal détectant UQCRFS1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour UQCRFS1 anticorps (N-Term) (ABIN634545)

Antigène: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UQCRFS1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UQCRFS1 anticorps

Épitope: N-Term

Specificité: UQCRFS1 antibody was raised against the N terminal of UQCRFS1

Purification: Affinity purified

Immunogène: UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UQCRFS1 Blocking Peptide, (ABIN5616923), is also available for use as a blocking control in assays to test for specificity of this UQCRFS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UQCRFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UQCRFS1

Antigène: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Autre désignation: UQCRFS1

Sujet: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Proton Transport