ADAM33 anticorps (Middle Region)

N° du produit ABIN634549

Cet anticorps Lapin Polyclonal détecte spécifiquement ADAM33 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour ADAM33 anticorps (Middle Region) (ABIN634549)

Antigène: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM33 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADAM33 anticorps

Épitope: Middle Region

Specificité: ADAM33 antibody was raised against the middle region of ADAM33

Purification: Affinity purified

Immunogène: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM33 Blocking Peptide, (ABIN939097), is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM33

Antigène: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Autre désignation: ADAM33

Sujet: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Poids moléculaire: 62 kDa (MW of target protein)