SHISA5 anticorps (Middle Region)

N° du produit ABIN634555

Détail du produit anti-SHISA5 anticorps

Antigène: SHISA5 (Shisa Homolog 5 (SHISA5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SHISA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SCOTIN antibody was raised against the middle region of Scotin

Purification: Affinity purified

Immunogène: SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCOTIN Blocking Peptide, catalog no. 33R-1648, is also available for use as a blocking control in assays to test for specificity of this SCOTIN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCOTIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SHISA5

Antigène: SHISA5 (Shisa Homolog 5 (SHISA5))

Autre désignation: SCOTIN (SHISA5 Produits)

Synonymes: anticorps SCOTIN, anticorps 2310008D10Rik, anticorps 6430628I05Rik, anticorps Scotin, anticorps mShisa5, anticorps shisa family member 5, anticorps SHISA5, anticorps Shisa5

Sujet: This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.

Poids moléculaire: 25 kDa (MW of target protein)