Heme Oxygenase anticorps

N° du produit ABIN634566

Détail du produit anti-Heme Oxygenase anticorps

Antigène: Heme Oxygenase (HMOX)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Heme Oxygenase Blocking Peptide, catalog no. 33R-2708, is also available for use as a blocking control in assays to test for specificity of this Heme Oxygenase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMOX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Heme Oxygenase

Antigène: Heme Oxygenase (HMOX)

Autre désignation: Heme Oxygenase (HMOX Produits)

Sujet: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter.

Poids moléculaire: 33 kDa (MW of target protein)