PDCD7 anticorps (Middle Region)

N° du produit ABIN634585

Détail du produit anti-PDCD7 anticorps

Antigène: PDCD7 (Programmed Cell Death 7 (PDCD7))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDCD7 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDCD7 antibody was raised against the middle region of PDCD7

Purification: Affinity purified

Immunogène: PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDCD7

Antigène: PDCD7 (Programmed Cell Death 7 (PDCD7))

Autre désignation: PDCD7 (PDCD7 Produits)

Synonymes: anticorps C80112, anticorps ES18, anticorps HES18, anticorps programmed cell death 7, anticorps Pdcd7, anticorps PDCD7

Sujet: PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.

Poids moléculaire: 55 kDa (MW of target protein)