PDCD7 anticorps (Middle Region)

N° du produit ABIN634585

Cet anticorps Lapin Polyclonal détecte spécifiquement PDCD7 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDCD7 anticorps (Middle Region) (ABIN634585)

Antigène: PDCD7 (Programmed Cell Death 7 (PDCD7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDCD7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDCD7 anticorps

Épitope: Middle Region

Specificité: PDCD7 antibody was raised against the middle region of PDCD7

Purification: Affinity purified

Immunogène: PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDCD7 Blocking Peptide, (ABIN936146), is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDCD7

Antigène: PDCD7 (Programmed Cell Death 7 (PDCD7))

Autre désignation: PDCD7

Sujet: PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.

Poids moléculaire: 55 kDa (MW of target protein)