PDCD7 anticorps (Middle Region)
-
- Antigène Voir toutes PDCD7 Anticorps
- PDCD7 (Programmed Cell Death 7 (PDCD7))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDCD7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDCD7 antibody was raised against the middle region of PDCD7
- Purification
- Affinity purified
- Immunogène
- PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
- Top Product
- Discover our top product PDCD7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDCD7 (Programmed Cell Death 7 (PDCD7))
- Autre désignation
- PDCD7 (PDCD7 Produits)
- Synonymes
- anticorps C80112, anticorps ES18, anticorps HES18, anticorps programmed cell death 7, anticorps Pdcd7, anticorps PDCD7
- Sujet
- PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.
- Poids moléculaire
- 55 kDa (MW of target protein)
-