BAG3 anticorps (Middle Region)

N° du produit ABIN634595

Détail du produit anti-BAG3 anticorps

Antigène: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAG3 est non-conjugé

Application: Western Blotting (WB)

Specificité: BAG3 antibody was raised against the middle region of BAG3

Purification: Affinity purified

Immunogène: BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BAG3 Blocking Peptide, catalog no. 33R-6927, is also available for use as a blocking control in assays to test for specificity of this BAG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAG3

Antigène: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Autre désignation: BAG3 (BAG3 Produits)

Synonymes: anticorps bag3-A, anticorps MGC53113, anticorps zgc:100859, anticorps BAG3, anticorps ATBAG3, anticorps BCL-2-associated athanogene 3, anticorps T28J14.160, anticorps T28J14_160, anticorps BAG-3, anticorps BIS, anticorps CAIR-1, anticorps MFM6, anticorps AA407278, anticorps Bis, anticorps mg638, anticorps BCL2 associated athanogene 3 L homeolog, anticorps BCL2-associated athanogene 3, anticorps BCL2 associated athanogene 3, anticorps BCL-2-associated athanogene 3, anticorps Bcl2-associated athanogene 3, anticorps bag3.L, anticorps bag3, anticorps BAG3, anticorps Bag3

Sujet: BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.

Poids moléculaire: 61 kDa (MW of target protein)