ELMOD2 anticorps (N-Term)

N° du produit ABIN634597

Cet anticorps Lapin Polyclonal détecte spécifiquement ELMOD2 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour ELMOD2 anticorps (N-Term) (ABIN634597)

Antigène: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELMOD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ELMOD2 anticorps

Épitope: N-Term

Specificité: ELMOD2 antibody was raised against the N terminal of ELMOD2

Purification: Affinity purified

Immunogène: ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELMOD2 Blocking Peptide, (ABIN938259), is also available for use as a blocking control in assays to test for specificity of this ELMOD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELMOD2

Antigène: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Autre désignation: ELMOD2

Sujet: ELMOD2 is an engulfment and motility (ELMO) domain-containing protein.

Poids moléculaire: 35 kDa (MW of target protein)