Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

TUBB anticorps (N-Term)

TUBB Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN634598
  • Antigène Voir toutes TUBB Anticorps
    TUBB (Tubulin, beta (TUBB))
    Épitope
    • 30
    • 17
    • 11
    • 10
    • 8
    • 7
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivité
    • 169
    • 144
    • 134
    • 42
    • 29
    • 23
    • 19
    • 16
    • 15
    • 13
    • 12
    • 11
    • 8
    • 6
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 109
    • 71
    • 1
    • 1
    • 1
    Lapin
    Clonalité
    • 96
    • 83
    • 2
    Polyclonal
    Conjugué
    • 95
    • 9
    • 8
    • 7
    • 6
    • 6
    • 6
    • 6
    • 6
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Cet anticorp TUBB est non-conjugé
    Application
    • 162
    • 48
    • 39
    • 39
    • 32
    • 31
    • 29
    • 28
    • 15
    • 13
    • 11
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificité
    Beta Tubulin antibody was raised against the N terminal of TUBB
    Purification
    Affinity purified
    Immunogène
    Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF
    Top Product
    Discover our top product TUBB Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    Beta Tubulin Blocking Peptide, catalog no. 33R-10122, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    TUBB (Tubulin, beta (TUBB))
    Autre désignation
    beta Tubulin (TUBB Produits)
    Synonymes
    anticorps M40, anticorps OK/SW-cl.56, anticorps TUBB1, anticorps TUBB5, anticorps XLOT, anticorps m40, anticorps ok/sw-cl.56, anticorps tubb1, anticorps tubb5, anticorps TUBB2A, anticorps TUBB2B, anticorps TUBB, anticorps 1t, anticorps B1t, anticorps BETA 56D, anticorps CG9277, anticorps DTB2, anticorps Dmbeta1, anticorps Dmel\\CG9277, anticorps T, anticorps Tub, anticorps Tubulin, anticorps beta, anticorps beta-Tub, anticorps beta-Tub56D, anticorps beta-tub, anticorps beta-tubulin56D, anticorps beta1, anticorps beta1-Tubulin, anticorps beta1-tub, anticorps beta1Tub, anticorps beta1t, anticorps beta1tub, anticorps beta56D, anticorps betaTub, anticorps betaTub1, anticorps beta[[1]] tubulin, anticorps beta[[1]]-tubulin, anticorps betatub(56D), anticorps 143391_i_at, anticorps 3t, anticorps B3t, anticorps BETA 60D, anticorps CG3401, anticorps D.m.BETA-60D, anticorps DTB3, anticorps Dmbeta3, anticorps Dmel\\CG3401, anticorps Tub60D, anticorps beta-Tub60D, anticorps beta-Tub6D, anticorps beta3, anticorps beta3 TU, anticorps beta3-Tub, anticorps beta3-tubulin, anticorps beta3TUB, anticorps beta3Tub, anticorps beta3t, anticorps beta60C, anticorps betaTub3, anticorps betaTub60C, anticorps beta[[3]] tubulin, anticorps beta[[3]]-Tub, anticorps beta[[3]]-tubulin, anticorps betatub60D, anticorps p50, anticorps p50/tubulin, anticorps p53, anticorps p53/tubulin, anticorps 2t, anticorps B2t, anticorps BETA 85D, anticorps BETA2, anticorps CG9359, anticorps D.m.BETA-85D, anticorps DTB4, anticorps Dmbeta2, anticorps Dmel\\CG9359, anticorps beta(2)Tu, anticorps beta(2)Tub, anticorps beta-Tub85D, anticorps beta-tub85D, anticorps beta2, anticorps beta2-tub, anticorps beta2t, anticorps beta2tub, anticorps beta85D, anticorps betaTub2, anticorps beta[[2]]-tubulin, anticorps ms(3)KK[D], anticorps 4t, anticorps B4t, anticorps BETA 98B, anticorps CG4869, anticorps DTB1, anticorps Dmbeta4, anticorps Dmel\\CG4869, anticorps beta-Tub97EF, anticorps beta4, anticorps beta4t, anticorps beta97F, anticorps betaTub4, anticorps betaTub98BC, anticorps betaTub98C, anticorps Tub1, anticorps bmtub1, anticorps Tub3, anticorps bmtub3, anticorps Tub2, anticorps bmtub2, anticorps Tub4, anticorps bmtub4, anticorps LOC100101153, anticorps tubulin beta class I, anticorps putative cobalt-zinc-cadmium outer membrane resistance protein, anticorps Tubulin beta chain, anticorps tubulin beta-2A chain, anticorps beta-Tubulin at 56D, anticorps beta-Tubulin at 60D, anticorps beta-Tubulin at 85D, anticorps beta-Tubulin at 97EF, anticorps beta-tubulin, anticorps tubulin beta 6 class V, anticorps beta tubulin, anticorps tubulin beta class I L homeolog, anticorps tubulin, beta 5 class I, anticorps TUBB, anticorps czcC, anticorps tbb-6, anticorps tubb, anticorps LOC462399, anticorps betaTub56D, anticorps betaTub60D, anticorps betaTub85D, anticorps betaTub97EF, anticorps Tub1, anticorps Tub3, anticorps Tub2, anticorps Tub4, anticorps TVAG_525430, anticorps TVAG_062880, anticorps TVAG_456920, anticorps LOC100101153, anticorps TUBB6, anticorps Tb927.1.2330, anticorps Tb927.1.2350, anticorps Tb927.1.2370, anticorps Tb927.1.2390, anticorps tubb.L, anticorps Tubb, anticorps LOC693049, anticorps LOC443015, anticorps Tubb5
    Sujet
    TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
    Poids moléculaire
    50 kDa (MW of target protein)
    Pathways
    Dynamique des Microtubules, M Phase
Vous êtes ici:
Support technique