Symplekin anticorps (N-Term)

N° du produit ABIN634602

Cet anticorps anti-Symplekin est un anticorps Lapin Polyclonal détectant Symplekin dans WB. Adapté pour Humain.

Aperçu rapide pour Symplekin anticorps (N-Term) (ABIN634602)

Antigène: Symplekin (SYMPK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Symplekin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Symplekin anticorps

Épitope: N-Term

Specificité: Symplekin antibody was raised against the N terminal of SYMPK

Purification: Affinity purified

Immunogène: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Symplekin Blocking Peptide, (ABIN5616468), is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Symplekin

Antigène: Symplekin (SYMPK)

Autre désignation: Symplekin

Sujet: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Poids moléculaire: 141 kDa (MW of target protein)