ARMC3 anticorps (Middle Region)

N° du produit ABIN634605

Détail du produit anti-ARMC3 anticorps

Antigène: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARMC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARMC3 antibody was raised against the middle region of ARMC3

Purification: Affinity purified

Immunogène: ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARMC3 Blocking Peptide, catalog no. 33R-10121, is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARMC3

Antigène: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Autre désignation: ARMC3 (ARMC3 Produits)

Synonymes: anticorps 4921513G22Rik, anticorps MGC76186, anticorps CT81, anticorps KU-CT-1, anticorps armadillo repeat containing 3, anticorps putative armc3, anticorps Armc3, anticorps armc3, anticorps ARMC3, anticorps Smp_105950

Sujet: Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.

Poids moléculaire: 96 kDa (MW of target protein)