Claudin 16 anticorps (C-Term)

N° du produit ABIN634606

Cet anticorps Lapin Polyclonal détecte spécifiquement Claudin 16 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Claudin 16 anticorps (C-Term) (ABIN634606)

Antigène: Claudin 16 (CLDN16)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 16 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Claudin 16 anticorps

Épitope: C-Term

Specificité: Claudin 16 antibody was raised against the C terminal of CLDN16

Purification: Affinity purified

Immunogène: Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 16

Antigène: Claudin 16 (CLDN16)

Autre désignation: Claudin 16

Sujet: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Hepatitis C