Claudin 1 anticorps (C-Term)

N° du produit ABIN634607

Détail du produit anti-Claudin 1 anticorps

Antigène: Claudin 1 (CLDN1)

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Claudin 1 antibody was raised against the C terminal of CLDN1

Purification: Affinity purified

Immunogène: Claudin 1 antibody was raised using the C terminal of CLDN1 corresponding to a region with amino acids GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Information d'application

Indications d'application: WB: 1-5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 1 Blocking Peptide, catalog no. 33R-3488, is also available for use as a blocking control in assays to test for specificity of this Claudin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 1

Antigène: Claudin 1 (CLDN1)

Autre désignation: Claudin 1 (CLDN1 Produits)

Synonymes: anticorps CLD1, anticorps ILVASC, anticorps SEMP1, anticorps AI596271, anticorps cldn19, anticorps claudin-1, anticorps cld1, anticorps ilvasc, anticorps semp1, anticorps CLDN1, anticorps claudin 1, anticorps claudin 1 S homeolog, anticorps CLDN1, anticorps Cldn1, anticorps cldn1, anticorps cldn1.S

Sujet: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C