NPHP1 anticorps

N° du produit ABIN634609

Détail du produit anti-NPHP1 anticorps

Antigène: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPHP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NPHP1 Blocking Peptide, catalog no. 33R-3334, is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPHP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NPHP1

Antigène: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Autre désignation: NPHP1 (NPHP1 Produits)

Synonymes: anticorps JBTS4, anticorps NPH1, anticorps SLSN1, anticorps nephrocystin-1, anticorps NPHP1, anticorps im:7162391, anticorps wu:fi59g07, anticorps zgc:152930, anticorps Nphp1, anticorps nephrocystin 1, anticorps nephronophthisis 1 (juvenile) homolog (human), anticorps nephronophthisis 1 (juvenile) L homeolog, anticorps nephronophthisis 1, anticorps nephrocystin-1, anticorps NPHP1, anticorps Nphp1, anticorps nphp1.L, anticorps nphp1, anticorps LOC100725987

Sujet: Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.

Poids moléculaire: 83 kDa (MW of target protein)