Ig anticorps

N° du produit ABIN634611

Cet anticorps anti-Ig est un anticorps Lapin Polyclonal détectant Ig dans WB. Adapté pour Humain.

Aperçu rapide pour Ig anticorps (ABIN634611)

Antigène: Ig

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ig est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Ig anticorps

Purification: Affinity purified

Immunogène: ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGDIG Blocking Peptide, (ABIN937278), is also available for use as a blocking control in assays to test for specificity of this ARHGDIG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGDIG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ig

Antigène: Ig

Sujet: ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.

Poids moléculaire: 25 kDa (MW of target protein)