TJP1 anticorps

N° du produit ABIN634615

Cet anticorps Lapin Polyclonal détecte spécifiquement TJP1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour TJP1 anticorps (ABIN634615)

Antigène: TJP1 (Tight Junction Protein 1 (TJP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TJP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TJP1 anticorps

Purification: Affinity purified

Immunogène: TJP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TJP1 Blocking Peptide, (ABIN5616617), is also available for use as a blocking control in assays to test for specificity of this TJP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TJP1

Antigène: TJP1 (Tight Junction Protein 1 (TJP1))

Autre désignation: TJP1

Sujet: TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell junctions.

Poids moléculaire: 187 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cell-Cell Junction Organization