MYBPH anticorps (N-Term)

N° du produit ABIN634622

L’anticorps Lapin Polyclonal anti-MYBPH a été validé pour WB. Il convient pour détecter MYBPH dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MYBPH anticorps (N-Term) (ABIN634622)

Antigène: MYBPH (Myosin Binding Protein H (MYBPH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYBPH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MYBPH anticorps

Épitope: N-Term

Specificité: MYBPH antibody was raised against the N terminal of MYBPH

Purification: Affinity purified

Immunogène: MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYBPH Blocking Peptide, (ABIN940299), is also available for use as a blocking control in assays to test for specificity of this MYBPH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYBPH

Antigène: MYBPH (Myosin Binding Protein H (MYBPH))

Autre désignation: MYBPH

Sujet: MYBPH binds to myosin, probably involved in interaction with thick myofilaments in the A-band.

Poids moléculaire: 52 kDa (MW of target protein)