Parvin, beta anticorps (C-Term)

N° du produit ABIN634626

Cet anticorps anti-Parvin, beta est un anticorps Lapin Polyclonal détectant Parvin, beta dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Parvin, beta anticorps (C-Term) (ABIN634626)

Antigène: Parvin, beta (PARVB)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Parvin, beta est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Parvin, beta anticorps

Épitope: C-Term

Specificité: PARVB antibody was raised against the C terminal of PARVB

Purification: Affinity purified

Immunogène: PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARVB Blocking Peptide, (ABIN939189), is also available for use as a blocking control in assays to test for specificity of this PARVB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARVB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Parvin, beta

Antigène: Parvin, beta (PARVB)

Autre désignation: PARVB

Sujet: Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.

Poids moléculaire: 45 kDa (MW of target protein)