PNN anticorps (N-Term)

N° du produit ABIN634627

Détail du produit anti-PNN anticorps

Antigène: PNN (Pinin, Desmosome Associated Protein (PNN))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNN est non-conjugé

Application: Western Blotting (WB)

Specificité: PNN antibody was raised against the N terminal of PNN

Purification: Affinity purified

Immunogène: PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNN

Antigène: PNN (Pinin, Desmosome Associated Protein (PNN))

Autre désignation: PNN (PNN Produits)

Synonymes: anticorps DRS, anticorps DRSP, anticorps SDK3, anticorps memA, anticorps wu:fb24d03, anticorps pnn, anticorps MGC88923, anticorps PNN, anticorps AU045199, anticorps D12Ertd512e, anticorps CG8383, anticorps Dmel\\CG8383, anticorps dPnn, anticorps pinin, desmosome associated protein, anticorps pinin, anticorps Pinin, anticorps PNN, anticorps Pnn, anticorps pnn, anticorps LOC100380709

Sujet: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene, the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.

Poids moléculaire: 81 kDa (MW of target protein)